PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000246482
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 370aa    MW: 41520.1 Da    PI: 7.4495
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000246482genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1775e-5551311129
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    lppGfrFhPtdeel+++yL++kv++ +++  +++++vd++k+ePwdLp k++ +ekewyfF  rd+ky+tg r+nrat++gyWk+tgkdke+++ +
  MDP0000246482   5 LPPGFRFHPTDEELITHYLCHKVSDVSFTS-KAVADVDLNKCEPWDLPGKASMGEKEWYFFNLRDRKYPTGLRTNRATEAGYWKTTGKDKEIHR-T 98 
                    79*************************999.88***************988999***************************************9.9 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrle 129
                    g lvg+kktLvfykgrap+gek++Wvmheyrle
  MDP0000246482  99 GVLVGMKKTLVFYKGRAPRGEKSNWVMHEYRLE 131
                    9******************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-633151IPR003441NAC domain
PROSITE profilePS5100559.6935151IPR003441NAC domain
PfamPF023652.1E-286130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MQESLPPGFR FHPTDEELIT HYLCHKVSDV SFTSKAVADV DLNKCEPWDL PGKASMGEKE  60
WYFFNLRDRK YPTGLRTNRA TEAGYWKTTG KDKEIHRTGV LVGMKKTLVF YKGRAPRGEK  120
SNWVMHEYRL ENKHPFKSSK EEWVVCRVFQ KSISALKKPQ QATTSSHQQP SIESPCDDTN  180
SIVNEFGDIE LPNLNSNINA NSSSGFSNNI SSPPSYYSNI IDHSKNNIND VTNMSLNMNW  240
AATAAREAAV NAVSWPSSLL SPSNLSVNSL LLRALHLRSS TNNNGSNYQP RDTNHGQATA  300
GTSTLDYSSY NTMQQQGMMP SISHHIGSST TMDHINSNFQ ASSSSIKDQM MESMPPQQHS  360
EQPFNLDSIW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-59215714171NO APICAL MERISTEM PROTEIN
1ut4_B1e-59215714171NO APICAL MERISTEM PROTEIN
1ut7_A1e-59215714171NO APICAL MERISTEM PROTEIN
1ut7_B1e-59215714171NO APICAL MERISTEM PROTEIN
4dul_A1e-59215714171NAC domain-containing protein 19
4dul_B1e-59215714171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008356654.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
RefseqXP_008374753.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1
TrEMBLM5WUQ11e-162M5WUQ1_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s03700.11e-150(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49463356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-107NAC domain containing protein 58